PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00055766001
Common NameGSBRNA2T00055766001, LOC106346763
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 164aa    MW: 18075.8 Da    PI: 8.3718
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00055766001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260143.27.8e-45131121100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +CaaCk+lrrkC++dCv+apyfpa++p kfa+vhk+FGasnv k+l+ l+e++r+da++s+vyeA+ar++dPvyG+vg+i++lq+qle+l
  GSBRNA2T00055766001  13 PCAACKLLRRKCVEDCVFAPYFPAKEPYKFAIVHKIFGASNVNKMLQVLSENHRSDAVNSIVYEANARVQDPVYGCVGIISSLQRQLETL 102
                          7***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          +++la +++e
  GSBRNA2T00055766001 103 QTQLAFAQAE 112
                          *****99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.49312113IPR004883Lateral organ boundaries, LOB
PfamPF031954.1E-4313110IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 164 aa     Download sequence    Send to blast
MRRKGHSHGA VSPCAACKLL RRKCVEDCVF APYFPAKEPY KFAIVHKIFG ASNVNKMLQV  60
LSENHRSDAV NSIVYEANAR VQDPVYGCVG IISSLQRQLE TLQTQLAFAQ AELVHMKTLH  120
RIDTKPPPYM ASGISFPANK DLSNDVDMAF AYENGAGESL WSC*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009149087.11e-122PREDICTED: LOB domain-containing protein 3
RefseqXP_013641646.11e-122PREDICTED: LOB domain-containing protein 3-like isoform X1
SwissprotQ9SA511e-100LBD3_ARATH; LOB domain-containing protein 3
TrEMBLA0A078JJD71e-122A0A078JJD7_BRANA; BnaA06g38340D protein
TrEMBLM4EB831e-122M4EB83_BRARP; Uncharacterized protein
STRINGBra026042.1-P1e-121(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G16530.11e-90ASYMMETRIC LEAVES 2-like 9
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]